SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035077 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035077
Domain Number 1 Region: 356-706
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.86e-141
Family Transferrin 0.0000000000938
Further Details:      
 
Domain Number 2 Region: 23-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.55e-123
Family Transferrin 0.000000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035077   Gene: ENSMUSG00000032496   Transcript: ENSMUST00000035077
Sequence length 707
Comment pep:known chromosome:GRCm38:9:111019292:111042766:1 gene:ENSMUSG00000032496 transcript:ENSMUST00000035077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLIPSLIFLEALGLCLAKATTVQWCAVSNSEEEKCLRWQNEMRKVGGPPLSCVKKSST
RQCIQAIVTNRADAMTLDGGTMFDAGKPPYKLRPVAAEVYGTKEQPRTHYYAVAVVKNSS
NFHLNQLQGLRSCHTGIGRSAGWKIPIGTLRPYLNWNGPPASLEEAVSKFFSKSCVPGAQ
KDRFPNLCSSCAGTGANKCASSPEEPYSGYAGALRCLRDNAGDVAFTRGSTVFEELPNKA
ERDQYKLLCPDNTWKPVTEYKECHLAQVPSHAVVSRSTNDKEEAIWELLRQSQEKFGKKQ
ASGFQLFASPSGQKDLLFKESAIGFVRVPQKVDVGLYLTFSYTTSIQNLNKKQQDVIASK
ARVTWCAVGSEEKRKCDQWNRASRGRVTCISFPTTEDCIVAIMKGDADAMSLDGGYIYTA
GKCGLVPVLAENQKSSKSNGLDCVNRPVEGYLAVAAVRREDAGFTWSSLRGKKSCHTAVD
RTAGWNIPMGLLANQTRSCKFNEFFSQSCAPGADPKSNLCALCIGDEKGENKCAPNSKER
YQGYTGALRCLAEKAGNVAFLKDSTVLQNTDGKNTEEWARNLKLKDFELLCLDDTRKPVT
EAKNCHLAIAPNHAVVSRTDKVEVLQQVLLDQQVQFGRNGQRCPGEFCLFQSKTKNLLFN
DNTECLAKIPGKTTSEKYLGKEYVIATERLKQCSSSPLLEACAFLTQ
Download sequence
Identical sequences P08071
NP_032548.2.92730 ENSMUSP00000035077 10090.ENSMUSP00000035077 ENSMUSP00000035077 ENSMUSP00000035077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]