SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035163 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035163
Domain Number 1 Region: 352-699
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.39e-131
Family Transferrin 0.00000000103
Further Details:      
 
Domain Number 2 Region: 21-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.24e-115
Family Transferrin 0.00000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035163   Gene: ENSMUSG00000033688   Transcript: ENSMUST00000035163
Sequence length 700
Comment pep:known chromosome:GRCm38:9:103250521:103288297:-1 gene:ENSMUSG00000033688 transcript:ENSMUST00000035163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLICALLCLGTLGLCLALPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVR
KMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMA
KKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKM
FPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRD
QYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSP
FQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRGLEDSQRVKWCAV
GQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPV
LAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGW
NVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSS
GALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCH
LARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLS
NLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY
Download sequence
Identical sequences Q9DBD0
ENSMUSP00000035163 ENSMUSP00000035163 10090.ENSMUSP00000035163 ENSMUSP00000035163 NP_082194.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]