SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035211 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035211
Domain Number 1 Region: 469-714
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.81e-60
Family Eukaryotic proteases 0.0000711
Further Details:      
 
Domain Number 2 Region: 375-469
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-35
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 3 Region: 191-275
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-34
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 4 Region: 290-374
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-31
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 5 Region: 98-189
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-29
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 6 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.73e-16
Family Hairpin loop containing domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035211   Gene: ENSMUSG00000032591   Transcript: ENSMUST00000035211
Sequence length 716
Comment pep:known chromosome:GRCm38:9:108080436:108085027:1 gene:ENSMUSG00000032591 transcript:ENSMUST00000035211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLVQCSRALGQRSPLNDFQLFRGTELRNLLHTAVPGPWQEDVADAEECARRC
GPLLDCRAFHYNMSSHGCQLLPWTQHSLHTQLYHSSLCHLFQKKDYVRTCIMDNGVSYRG
TVARTAGGLPCQAWSRRFPNDHKYTPTPKNGLEENFCRNPDGDPRGPWCYTTNRSVRFQS
CGIKTCREAVCVLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFQPEKFLDKDLKDNYC
RNPDGSERPWCYTTDPNVEREFCDLPSCGPNLPPTVKGSKSQRRNKGKALNCFRGKGEDY
RGTTNTTSAGVPCQRWDAQSPHQHRFVPEKYACKDLRENFCRNPDGSEAPWCFTSRPGLR
MAFCHQIPRCTEELVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPQ
AGLEANFCRNPDGDSHGPWCYTLDPDILFDYCALQRCDDDQPPSILDPPDQVVFEKCGKR
VDKSNKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCIWSCHEPLTGYE
VWLGTINQNPQPGEANLQRVPVAKAVCGPAGSQLVLLKLERPVILNHHVALICLPPEQYV
VPPGTKCEIAGWGESIGTSNNTVLHVASMNVISNQECNTKYRGHIQESEICTQGLVVPVG
ACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWINKVMQLE
Download sequence
Identical sequences P26928
ENSMUSP00000035211 ENSMUSP00000035211 10090.ENSMUSP00000035211 NP_032269.3.92730 ENSMUSP00000035211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]