SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035498 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035498
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.66e-137
Family Protein prenyltransferases 0.00000000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035498   Gene: ENSMUSG00000033373   Transcript: ENSMUST00000041008
Sequence length 437
Comment pep:known chromosome:GRCm38:12:76837414:76921412:1 gene:ENSMUSG00000033373 transcript:ENSMUST00000041008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSSFTYYCPPSSSPVWSEPLYSLRPEHVRERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLILQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
IVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQY
LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF
YHTCYCLSGLSIAQHFGSGAMLHDMVMGVPENVLQPTHPVYNIGPEKVIQATTHFLQKPV
PGFEECEDEVTSDPATD
Download sequence
Identical sequences Q8K2I1
NP_666039.1.92730 ENSMUSP00000035498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]