SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035585 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035585
Domain Number 1 Region: 46-299
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.5e-77
Family Carbonic anhydrase 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035585   Gene: ENSMUSG00000056158   Transcript: ENSMUST00000042943
Sequence length 328
Comment pep:known chromosome:GRCm38:11:93098404:93601745:1 gene:ENSMUSG00000056158 transcript:ENSMUST00000042943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGG
PMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLV
VVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMT
IPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN
INFSLQGKDCPNNRAQKLQYRVNEWLLK
Download sequence
Identical sequences A0A1S3A411 A0A1U7UIT4 A0A1U8C105 A0A2I3MEL8 A0A2J8W884 A0A2K5DH97 A0A2K5HMK6 A0A2K5N955 A0A2K5RUI6 A0A2K5ZMW5 A0A2K6GPW6 A0A2K6LMT4 A0A2K6Q0Z2 A0A2K6TGW6 F7GIT9 G1R914 G1SHC4 H0VTH4 H2QDG4 H9EPV1 I3MRF7 J9NUK2 M0R8A5 M3VY78 M3YVZ0 P61215 Q3V1V7 Q5R4U0 Q9N085 Q9NS85
NP_001076002.1.87134 NP_001076002.1.92137 NP_001076003.1.87134 NP_001076003.1.92137 NP_001253312.1.72884 NP_001270201.1.63531 NP_064563.1.87134 NP_064563.1.92137 NP_082572.1.92730 XP_001171455.1.37143 XP_001171487.1.37143 XP_002748458.1.60252 XP_003272320.1.23891 XP_003272321.1.23891 XP_003800070.1.62490 XP_003931366.1.74449 XP_003996726.1.62641 XP_004480527.1.11602 XP_005321663.1.77405 XP_005886020.1.60319 XP_006153658.1.99106 XP_006534382.1.92730 XP_006764091.1.95426 XP_006924908.1.64745 XP_006924909.1.64745 XP_006972069.1.50099 XP_007086754.1.5354 XP_007528985.1.11023 XP_007611659.1.28591 XP_008009616.1.81039 XP_008009617.1.81039 XP_008070070.1.4292 XP_008145975.1.99482 XP_008145976.1.99482 XP_008145977.1.99482 XP_008269497.1.1745 XP_008968868.1.60992 XP_008968869.1.60992 XP_008995601.1.60252 XP_010340235.1.74449 XP_010340236.1.74449 XP_010370501.1.97406 XP_010370502.1.97406 XP_010370503.1.97406 XP_011815386.1.43180 XP_011815387.1.43180 XP_011854605.1.47321 XP_011910238.1.92194 XP_011910239.1.92194 XP_012319007.1.9421 XP_012319008.1.9421 XP_012319009.1.9421 XP_012521133.1.63892 XP_012918119.1.14098 XP_012933196.1.39548 XP_012973156.1.91757 XP_012973157.1.91757 XP_013203025.1.66349 XP_013972141.1.84170 XP_014943855.1.86478 XP_015350944.1.40921 XP_015350945.1.40921 XP_016058851.1.3490 XP_017170284.1.92730 XP_017204623.1.1745 XP_017204624.1.1745 XP_017395702.1.71028 XP_017395703.1.71028 XP_017453181.1.100692 XP_017459605.1.4139 XP_017713753.1.44346 XP_019271265.1.44245 XP_019271266.1.44245 XP_019271267.1.44245 XP_019586576.1.88060 XP_019586577.1.88060 XP_019586578.1.88060 XP_019673221.1.62641 XP_020136488.1.48125 XP_020136489.1.48125 XP_020136490.1.48125 XP_020922898.1.46622 XP_020922899.1.46622 XP_020922900.1.46622 XP_020922901.1.46622 XP_021068774.1.100879 XP_021579776.1.77405 ENSPPYP00000009286 ENSPPYP00000009286 ENSMPUP00000015500 ENSMUSP00000035585 ENSMUSP00000103495 10090.ENSMUSP00000035585 10141.ENSCPOP00000013970 9544.ENSMMUP00000018062 9600.ENSPPYP00000009286 9606.ENSP00000285273 9986.ENSOCUP00000002025 ENSCPOP00000013970 ENSSTOP00000014664 ENSP00000285273 ENSP00000390666 ENSP00000405388 ENSOCUP00000002025 ENSMMUP00000018062 ENSCAFP00000036841 ENSDNOP00000020186 ENSCAFP00000036841 ENSMUSP00000035585 ENSMMUP00000018062 ENSCJAP00000020988 ENSPTRP00000016004 ENSCPOP00000013970 ENSP00000285273 ENSP00000390666 ENSP00000405388 ENSOCUP00000002025 ENSMPUP00000015500 ENSNLEP00000009701 ENSNLEP00000009701 ENSCJAP00000020988 ENSCJAP00000020993 ENSSTOP00000014664 ENSFCAP00000002102 gi|130979679|ref|NP_001076002.1| gi|130979954|ref|NP_001076003.1| gi|9910366|ref|NP_064563.1| ENSMUSP00000035585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]