SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036177 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036177
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily DNA clamp 0.0000000000000126
Family DNA polymerase processivity factor 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000036177
Domain Number - Region: 153-233
Classification Level Classification E-value
Superfamily DNA clamp 0.00377
Family DNA polymerase processivity factor 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036177   Gene: ENSMUSG00000038569   Transcript: ENSMUST00000049009
Sequence length 403
Comment pep:known chromosome:GRCm38:5:122325508:122354233:-1 gene:ENSMUSG00000038569 transcript:ENSMUST00000049009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMTGGQVKVFGKAVQTLSRVSDELWLDPSEKGLALRSVNSCHSTYGYVLFSSMFFQ
HYQWSPFATMSDTDLPLNLNCKLAIKSVLPIFRCLNYLERSVEKCTVVARADKCRVVIQF
FGKHGIKRTHNVYFQDSQPLKIIFEKSLCANILMIKPRLLTEAIALLTSNQEEVTFSVTP
GNFCLKSLSGELLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHA
PLAIYFDFPGKPVVLSVEDMLLEANFILATLVDYPSRTSSPQLLPLSQARRSHPIQSSAP
EDKSRVSQTPESISRAAPKRLFPKDSPDSSSAAETKRASAGQDDIFEVPESVVSDMEEER
SPSHLRKFSCMFFGAVSCEQQEYAGHPLDSLAVASDSEEDVSG
Download sequence
Identical sequences Q6WBX7 Q8VC54
ENSMUSP00000036177 NP_659161.2.92730 MmR257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]