SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036921 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036921
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-22
Family Kringle modules 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036921   Gene: ENSMUSG00000034614   Transcript: ENSMUST00000045153
Sequence length 264
Comment pep:known chromosome:GRCm38:11:3330401:3342971:1 gene:ENSMUSG00000034614 transcript:ENSMUST00000045153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLT
EPSPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQAPPPSSAMELEEK
SGAPGDKEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYVLGITMMV
IILAIGAGIIVGYTYKRGKDLKEQHEKKACEREMQRITLPLSAFTNPTCETVDENTIIVH
SNQTPADVQEGSTLLTGQAGTPGA
Download sequence
Identical sequences Q7TMJ8
NP_835362.2.92730 ENSMUSP00000036921 10090.ENSMUSP00000036921 ENSMUSP00000036921 ENSMUSP00000036921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]