SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037539 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037539
Domain Number 1 Region: 21-124
Classification Level Classification E-value
Superfamily POZ domain 1.55e-28
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037539   Gene: ENSMUSG00000041633   Transcript: ENSMUST00000039424
Sequence length 292
Comment pep:known chromosome:GRCm38:X:153685154:153696280:-1 gene:ENSMUSG00000041633 transcript:ENSMUST00000039424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMPEKSSDVKPTEECGSFPEIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLI
QDNKGRFFIDRDGFLFRYVLDYMRDMQVVLPDHFPECGRLHREAEYFKLPELAKMLAPKM
NKLNSIGNDSCPIDLEELSPSIDTTFNFSSTNSIHISGPDNPMVLRAAPGSELKKAGFIT
IGYRGSYTLGRDSQADAKFRRVARIMVCGKISLAKEVFGDTLNESRDPDRPPERYTSRYY
LKFTFLEQAFDKLADAGFHMVACNSTGTCTVTHDQTDDRIWTSYTEYVFYRE
Download sequence
Identical sequences Q8C7J6
NP_780638.1.92730 XP_006528841.1.92730 GO.36202 MmR291 ENSMUSP00000037539 10090.ENSMUSP00000037539 ENSMUSP00000037539 ENSMUSP00000108191 ENSMUSP00000037539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]