SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037754 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037754
Domain Number 1 Region: 265-334
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 7.19e-21
Family Anaphylotoxins (complement system) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037754   Gene: ENSMUSG00000035875   Transcript: ENSMUST00000045776
Sequence length 356
Comment pep:known chromosome:GRCm38:2:35084046:35100685:-1 gene:ENSMUSG00000035875 transcript:ENSMUST00000045776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLIPSQAMGFWGTLLFLIFLEQSWGQEQTYIISTPIVFRVGAPENVTVQAHGHTEAFDT
TVSVKSYPDENVRYSFSTVNLSPENKFQNTAILTIQAKQLSEGQNSFSNSYLEVVSKHFA
KLEIVPIIYDNDSLFVQTDKSVYTPQQPVKVRVYSVNDDLEPATRETVLTFIDPEGSQVD
TIEGNNLTGIASFPDFEIPSNPKHGRWTVKAKYREDASKTGTTYFEVKEYDKTYRISIMP
TIDLQPEVEKQEAHGMCLHQPTECLRQKINEQASTYKHPMIKKCCYDGARYNIHETCVQR
AARVKIGPICVKAFTLCCNMAHQILENSTFKHIHLSSHSNHQAEHGDPQWRSQGKD
Download sequence
Identical sequences A2AS37
NP_849216.2.92730 ENSMUSP00000037754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]