SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038485 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038485
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.03e-59
Family Ran-binding protein mog1p 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038485   Gene: ENSMUSG00000032892   Transcript: ENSMUST00000038644
Sequence length 185
Comment pep:known chromosome:GRCm38:11:68972484:68973843:-1 gene:ENSMUSG00000032892 transcript:ENSMUST00000038644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNRNCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQG
EAAARYHFEDVGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPCHSRSLGPENLSCPPWSLSNFEQLVTSLTLHDPN
LFGPQ
Download sequence
Identical sequences Q9JIB0
ENSMUSP00000038485 10090.ENSMUSP00000038485 ENSMUSP00000038485 ENSMUSP00000038485 NP_067304.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]