SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038576 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038576
Domain Number 1 Region: 2400-2589
Classification Level Classification E-value
Superfamily BRCA2 helical domain 8.89e-84
Family BRCA2 helical domain 0.00000000378
Further Details:      
 
Domain Number 2 Region: 2752-2887
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.09e-60
Family BRCA2 tower domain 0.000000149
Further Details:      
 
Domain Number 3 Region: 2971-3102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-49
Family Single strand DNA-binding domain, SSB 0.000000262
Further Details:      
 
Domain Number 4 Region: 2590-2721
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.45e-44
Family Single strand DNA-binding domain, SSB 0.000000175
Further Details:      
 
Domain Number 5 Region: 2723-2752,2888-2970
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-36
Family Single strand DNA-binding domain, SSB 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038576   Gene: ENSMUSG00000041147   Transcript: ENSMUST00000044620
Sequence length 3329
Comment pep:known chromosome:GRCm38:5:150522630:150569746:1 gene:ENSMUSG00000041147 transcript:ENSMUST00000044620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVEYKRRPTFWEIFKARCSTADLGPISLNWFEELSSEAPPYNSEPPEESEYKPHGYEPQ
LFKTPQRNPPYHQFASTPIMFKERSQTLPLDQSPFRELGKVVASSKHKTHSKKKTKVDPV
VDVASPPLKSCLSESPLTLRCTQAVLQREKPVVSGSLFYTPKLKEGQTPKPISESLGVEV
DPDMSWTSSLATPPTLSSTVLIARDEEARSSVTPADSPATLKSCFSNHNESPQKNDRSVP
SVIDSENKNQQEAFSQGLGKMLGDSSGKRNSFKDCLRKPIPNILEDGETAVDTSEEDSFS
LCFPKRRTRNLQKMRMGKTRKKIFSETRTDELSEEARRQTDDKNSFVFEMELRESDPLDP
GVTSQKPFYSQNEEICNEAVQCSDSRWSQSNLSGLNETQTGKITLPHISSHSQNISEDFI
DMKKEGTGSITSEKSLPHISSLPEPEKMFSEETVVDKEHEGQHFESLEDSIAGKQMVSRT
SQAACLSPSIRKSIFKMREPLDETLGTVFSDSMTNSTFTEEHEASACGLGILTACSQRED
SICPSSVDTGSWPTTLTDTSATVKNAGLISTLKNKKRKFIYSVSDDASLQGKKLQTHRQL
ELTNLSAQLEASAFEVPLTFTNVNSGIPDSSDKKRCLPNDPEEPSLTNSFGTATSKEISY
IHALISQDLNDKEAIVIEEKPQPYTAREADFLLCLPERTCENDQKSPKVSNGKEKVLVSA
CLPSAVQLSSISFESQENPLGDHNGTSTLKLTPSSKLPLSKADMVSREKMCKMPEKLQCE
SCKVNIELSKNILEVNEICILSENSKTPGLLPPGENIIEVASSMKSQFNQNAKIVIQKDQ
KGSPFISEVAVNMNSEELFPDSGNNFAFQVTNKCNKPDLGSSVELQEEDLSHTQGPSLKN
SPMAVDEDVDDAHAAQVLITKDSDSLAVVHDYTEKSRNNIEQHQKGTEDKDFKSNSSLNM
KSDGNSDCSDKWSEFLDPVLNHNFGGSFRTASNKEIKLSEHNVKKSKMFFKDIEEQYPTR
LACIDIVNTLPLANQKKLSEPHIFDLKSVTTVSTQSHNQSSVSHEDTDTAPQMLSSKQDF
HSNNLTTSQKAEITELSTILEESGSQFEFTQFRKPSHIAQNTSEVPGNQMVVLSTASKEW
KDTDLHLPVDPSVGQTDHSKQFEGSAGVKQSFPHLLEDTCNKNTSCFLPNINEMEFGGFC
SALGTKLSVSNEALRKAMKLFSDIENSEEPSAKVGPRGFSSSAHHDSVASVFKIKKQNTE
KSFDEKSSKCQVTLQNNIEMTTCIFVGRNPEKYIKNTKHEDSYTSSQRNNLENSDGSMSS
TSGPVYIHKGDSDLPADQGSKCPESCTQYAREENTQIKENISDLTCLEIMKAEETCMKSS
DKKQLPSDKMEQNIKEFNISFQTASGKNTRVSKESLNKSVNIFNRETDELTVISDSLNSK
ILHGINKDKMHTSCHKKAISIKKVFEDHFPIVTVSQLPAQQHPEYEIESTKEPTLLSFHT
ASGKKVKIMQESLDKVKNLFDETQYVRKTASFSQGSKPLKDSKKELTLAYEKIEVTASKC
EEMQNFVSKETEMLPQQNYHMYRQTENLKTSNGTSSKVQENIENNVEKNPRICCICQSSY
PVTEDSALAYYTEDSRKTCVRESSLSKGRKWLREQGDKLGTRNTIKIECVKEHTEDFAGN
ASYEHSLVIIRTEIDTNHVSENQVSTLLSDPNVCHSYLSQSSFCHCDDMHNDSGYFLKNK
IDSDVPPDMKNAEGNTISPRVSATKERNLHPQTINEYCVQKLETNTSPHANKDVAIDPSL
LDSRNCKVGSLVFITAHSQETERTKEIVTDNCYKIVEQNRQSKPDTCQTSCHKVLDDSKD
FICPSSSGDVCINSRKDSFCPHNEQILQHNQSMSGLKKAATPPVGLETWDTSKSIREPPQ
AAHPSRTYGIFSTASGKAIQVSDASLEKARQVFSEMDGDAKQLSSMVSLEGNEKPHHSVK
RENSVVHSTQGVLSLPKPLPGNVNSSVFSGFSTAGGKLVTVSESALHKVKGMLEEFDLIR
TEHTLQHSPIPEDVSKILPQPCAEIRTPEYPVNSKLQKTYNDKSSLPSNYKESGSSGNTQ
SIEVSLQLSQMERNQDTQLVLGTKVSHSKANLLGKEQTLPQNIKVKTDEMKTFSDVPVKT
NVGEYYSKESENYFETEAVESAKAFMEDDELTDSEQTHAKCSLFTCPQNETLFNSRTRKR
GGVTVDAVGQPPIKRSLLNEFDRIIESKGKSLTPSKSTPDGTVKDRSLFTHHMSLEPVTC
GPFCSSKERQGAQRPHLTSPAQELLSKGHPWRHSALEKSPSSPIVSILPAHDVSATRTER
TRHSGKSTKVFVPPFKMKSQFHGDEHFNSKNVNLEGKNQKSTDGDREDGNDSHVRQFNKD
LMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQ
LYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEE
FYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYR
YDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTI
ELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKIS
ANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSGLY
IFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQ
DGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEE
GLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFE
RPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVVSV
VKPIGLAPLVYLSDECLNLLVVKFGIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFAGH
FSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLEGDSPKWSTPNKDPTREP
HAASTCCASDLLGSGGQFLRISPTGQQSYQSPLSHCTLKGKSMPLAHSAQMAAKSWSGEN
EIDDPKTCRKRRALDFLSRLPLPSPVSPICTFVSPAAQKAFQPPRSCGTKYATPIKKEPS
SPRRRTPFQKTSGVSLPDCDSVADEELALLSTQALTPDSVGGNEQAFPGDSTRNPQPAQR
PDQQVGPRSRKESLRDCRGDSSEKLAVES
Download sequence
Identical sequences P97929
ENSMUSP00000038576 10090.ENSMUSP00000038576 ENSMUSP00000038576 NP_001074470.1.92730 NP_033895.2.92730 XP_017176117.1.92730 ENSMUSP00000038576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]