SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039205 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039205
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-16
Family V set domains (antibody variable domain-like) 0.027
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000207
Family C1 set domains (antibody constant domain-like) 0.018
Further Details:      
 
Domain Number 3 Region: 242-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000348
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039205   Gene: ENSMUSG00000040511   Transcript: ENSMUST00000043517
Sequence length 408
Comment pep:known chromosome:GRCm38:7:19903578:19921160:-1 gene:ENSMUSG00000040511 transcript:ENSMUST00000043517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLARATRSPLSWLLLLFCYALRKAGGDIRVLVPYNSTGVLGGSTTLHCSLTSNENVTI
TQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGI
YECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWP
SNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQ
PYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNML
LISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGYIFLIVFVLAV
VIIIAALYTIRRCRHGRALQSNPSERENVQYSSVNGDCRLNMEPNSTR
Download sequence
Identical sequences Q8K094
ENSMUSP00000039205 ENSMUSP00000039205 NYSGRC-IgSF-NP_081790 NP_081790.1.92730 ENSMUSP00000039205 10090.ENSMUSP00000039205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]