SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040548 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040548
Domain Number 1 Region: 224-385,456-518
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.95e-22
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040548   Gene: ENSMUSG00000037579   Transcript: ENSMUST00000041415
Sequence length 1095
Comment pep:known chromosome:GRCm38:15:99224976:99242817:1 gene:ENSMUSG00000037579 transcript:ENSMUST00000041415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDNWKERGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYVGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQQEIESSESELPEIGWLQELARRLETPYYLVSRSPDGG
NSSGQSENCSSSSSSSGSGGGRGSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFG
NVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHR
IPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRG
CLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCEL
PQREQVVKANADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGV
SAEVDTSSLSGDNTLMSTLEEKETDGEQGHTVSPAPADEPSSPLLSPGCTSSSSAAKLLS
PRRTAPRPRLGGRGRPSRAGVLKPEAGPSAHPRSLDGLQLPPMPWNVPPDLSPRVVDGIE
DGCSSDQPKFSFRVGQSGPECSSSPSPGTESGLLTVPLGPSEARNTDTLDKLRQAVMELS
EQVLQMREGLQSLRQAVQLILVPQGEGQCPRGSGEEPCPATASGLLQPLRVDTGASSYCL
QPPAGSVLSGTWPHPRPGQPPPLMAPWPWGPPASQSSPWPRATALWTSTSDSEPPGSGDL
CSEPSTPASPPPSEEGARTGTPAPVSQAEATSTGEPPPGPGGRALPWDPHSLEMVLIGCH
GPGTVQWTQEEGTGV
Download sequence
Identical sequences Q9WVJ0
10090.ENSMUSP00000040548 ENSMUSP00000040548 ENSMUSP00000040548 ENSMUSP00000040548 NP_034731.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]