SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040580 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040580
Domain Number 1 Region: 14-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.65e-118
Family Aldose 1-epimerase (mutarotase) 0.0000000000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040580   Gene: ENSMUSG00000035473   Transcript: ENSMUST00000039205
Sequence length 342
Comment pep:known chromosome:GRCm38:17:80127471:80185101:1 gene:ENSMUSG00000035473 transcript:ENSMUST00000039205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVTRTVFGELPSGGGTVEKFQLRSDQLSVDIISWGCTITALQVKDRQGKASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTP
QVLTNGVQFFRVSPDGEEGYPGELKVWVTYTLDGGELVINYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDYHIH
GFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFSVA
Download sequence
Identical sequences Q8K157
ENSMUSP00000040580 NP_795937.1.92730 ENSMUSP00000040580 ENSMUSP00000040580 10090.ENSMUSP00000040580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]