SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040591 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040591
Domain Number 1 Region: 47-521
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-166
Family ALDH-like 0.0000000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040591   Gene: ENSMUSG00000035936   Transcript: ENSMUST00000037615
Sequence length 523
Comment pep:known chromosome:GRCm38:13:24907579:24937661:-1 gene:ENSMUSG00000035936 transcript:ENSMUST00000037615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFLLRSFWAARPALPPPGRFRPEPAGTPRRSYASGPGGLHADLLRGDSFVGGRWLPA
PATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFNSWKGVSVKERSLLLRKWYDLMI
QNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRIYGDIIYTSAKDKRGLVLK
QPVGVAAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSALALAQLANQAGIPAG
VYNVIPCSRNKAKEVGEVLCTDPLVSKISFTGSTATGKILLHHAANSVKRVSMELGGLAP
FIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDSFVTKFAEAMKKSLRVGN
GFEEGTTQGPLINEKAVEKVEKQVNDAVAKGATVVTGGKRHQSGGNFFEPTLLSNVTRDM
LCITEETFGPLAPVIKFDKEEEAVAIANAAEVGLAGYFYSQDPAQIWRVAEQLEVGMVGV
NEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
Download sequence
Identical sequences B2RS41 Q8BWF0
10090.ENSMUSP00000040591 ENSMUSP00000040591 ENSMUSP00000040591 NP_766120.1.92730 ENSMUSP00000040591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]