SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042271 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042271
Domain Number 1 Region: 958-1162
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000284
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000042271
Domain Number - Region: 490-543
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042271   Gene: ENSMUSG00000020859   Transcript: ENSMUST00000041956
Sequence length 1307
Comment pep:known chromosome:GRCm38:11:93996103:94126085:1 gene:ENSMUSG00000020859 transcript:ENSMUST00000041956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSDQLEATAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQP
RSHTSLKDELSDISQGGSKATTPASTANSDVSAIPPDTPSKEDNEGFVKGTDTSNKSEIS
KHIEVQVAQETRNVSTESGENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKA
FDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNVVKNDL
IAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSD
IPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQ
FFSRLFSSSSNATKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEET
EASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVANGQGETKMKNLPVPVY
LRPLDEKDASMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSL
DKLDQELKEQQKEFKNQEELSSQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLC
IASVPGARETDYPAGEELSESGQVDKASLCGSMTSNSSAEMDSLLGGITVVGCSTEGLTG
AATSPSTNGASPVIEKPPEMETENSEVDENIPTAEEATEATEGNAGSTEDTVDISQPGVY
TEHVFTDPLGVQIPEDLSPVFQSSNDSDVYKDQISVLPNEQDLAREEAQKMSSLLPTMWL
GAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWD
LSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQ
LAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVS
CNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAH
AQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKSMLVISG
GEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMCGNE
Download sequence
Identical sequences NP_081845.2.92730 ENSMUSP00000042271 ENSMUSP00000024979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]