SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043193 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043193
Domain Number 1 Region: 31-142
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-30
Family FKBP immunophilin/proline isomerase 0.00014
Further Details:      
 
Domain Number 2 Region: 168-316
Classification Level Classification E-value
Superfamily TPR-like 1.64e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043193   Gene: ENSMUSG00000040013   Transcript: ENSMUST00000044972
Sequence length 327
Comment pep:known chromosome:GRCm38:5:135291704:135349991:-1 gene:ENSMUSG00000040013 transcript:ENSMUST00000044972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVFSRLRNGIPPSRDDCQSPYERLSQRMLDISGDRGVLKDIIREGTGDTVTPDASVLVK
YSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGT
LGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNY
LFRQNRFCDAKVRYKRALLLLHRRLATCEEQHLVEPAVLLVLLNLSFVYLKLDRPAMALR
YGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDINNELKKLSSHY
RDYVDREREMCHRMFAPCGSRSSVGGN
Download sequence
Identical sequences NP_001264820.1.92730 NP_291049.1.92730 XP_011239215.1.92730 XP_017176679.1.92730 ENSMUSP00000043193 ENSMUSP00000043193 ENSMUSP00000043193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]