SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043250 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043250
Domain Number 1 Region: 507-663
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.48e-30
Family Growth factor receptor domain 0.00035
Further Details:      
 
Domain Number 2 Region: 902-1059
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.42e-28
Family Growth factor receptor domain 0.00075
Further Details:      
 
Domain Number 3 Region: 648-816
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.01e-26
Family Growth factor receptor domain 0.00025
Further Details:      
 
Domain Number 4 Region: 2915-3043
Classification Level Classification E-value
Superfamily CalX-like 1.12e-25
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 5 Region: 2554-2670
Classification Level Classification E-value
Superfamily CalX-like 4.19e-25
Family CalX-beta domain 0.0007
Further Details:      
 
Domain Number 6 Region: 3036-3179
Classification Level Classification E-value
Superfamily CalX-like 4.71e-24
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 7 Region: 2796-2911
Classification Level Classification E-value
Superfamily CalX-like 5.23e-20
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 8 Region: 2671-2796
Classification Level Classification E-value
Superfamily CalX-like 8.37e-20
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 9 Region: 420-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-19
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 10 Region: 808-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.44e-16
Family Growth factor receptor domain 0.0008
Further Details:      
 
Domain Number 11 Region: 145-216
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000638
Family VWC domain 0.033
Further Details:      
 
Domain Number 12 Region: 92-153
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000931
Family VWC domain 0.011
Further Details:      
 
Domain Number 13 Region: 218-278
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000167
Family VWC domain 0.011
Further Details:      
 
Domain Number 14 Region: 21-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000785
Family VWC domain 0.0046
Further Details:      
 
Domain Number 15 Region: 271-343
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000293
Family VWC domain 0.016
Further Details:      
 
Domain Number 16 Region: 366-421
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000126
Family VWC domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000043250
Domain Number - Region: 1046-1097
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00282
Family Growth factor receptor domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043250   Gene: ENSMUSG00000034687   Transcript: ENSMUST00000036019
Sequence length 4010
Comment pep:known chromosome:GRCm38:5:96373955:96784728:1 gene:ENSMUSG00000034687 transcript:ENSMUST00000036019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLKAWLGVALALAEFAVLPNCEGACLYQGSFLADATIWKPDSCQNCRCHGDIVICKPV
VCKNPRCAFEKGEVLWIAPNQCCPQCAPRTPGSCHHEGKIHEHGTEWASAPCTVCSCTHG
EVRCSHQQCTPLSCGPQELEFLAEGRCCPICVGTGKPCSYDGHVFQDGEDWQLSRCAKCV
CRNGLTQCFAAQCQPLFCNQDEIVVRVPGKCCSQCSARSCSTAGQVYEHGEQWKEDACTL
CMCDQGQVRCHKQVCPPLRCAKGQGRARHHGQCCEECATPDRSCSSGGVLRYQDEMWKGS
ACEFCMCDQGQVTCQTGECAKVACALGEELVHLEGKCCPECISRNGYCIYEQKAETMSSS
AREIKHVPDGEKWEEGPCKLCECREAQVTCYEPSCPPCPVATLALVVKGQCCPDCTPVHC
HPDCLTCSHSPDHCDLCQDPTKLLQNGRCVHSCGLGFYQAGSLCLACQPQCSTCTNGLEC
SSCLPPLLMQQGQCVSTCGDGFYQDHHSCAVCHESCAGCWGPTEKHCMACRDPLQVLRDS
SCENTCGNGFYNRQGTCVACDQSCKSCGPSSPRCLSCAEKTILHDGKCISECPHGYYADS
TGSCKVCHSSCASCSGPTAAHCIACIHPQTLRQGHCLPSCGEGFYPDHGICEACHASCHT
CVGPQPSHCTQCKKPEAGLLVEQHSGENVPYGKCVSRCGTHFYLESTGLCEVCHPSCLTC
EGKSPHNCTGCESTHALLAGCCVSQCPETHFNLEGTCTECHPSCRQCHGPLESDCVSCHP
HLTLTSGHCKTSCKEEQFLNLVGYCADCHPLCQHCVANLQDTGSICLKCQHARHLLLGDH
CVPECPPGHYKERGTCKTCHSSCRSCQNGGPFSCSSCDTGLVLTHIGTCSTACFPGHYLD
DNQVCQPCNRHCRSCDSQGSCTSCRDPSKVLLFGECQYESCTPQYYLDIATKTCKECDWS
CNACTGPLRTDCLQCMDGYVLQDGVCVEQCSPQHYRDSGSCKRCDSHCVECQGPHECTRC
EEPFLLFQAQCVQECGKGYFADHAKHRCIACPQGCLRCSHKDRCHLCDHSFFLKSGLCMP
TCVPGFSGHSSNENCTDKMYTPSLHVNGSLTLGIGSMKPLDFSLLNIQHQDGRVEDLLFH
VVSTPTNGQLLLSRNGKEVQLEKAGHFSWKDVNEKKVRFVHSKEKLRKGYFSLKISDQQF
FSEPQLINIQAFSTQAPYVLRNEVLHVSKGERATITTQLLDIRDDDNPQDVVVNVLDPPL
HGQLLQMPPAPAASIYQFHLDELSRGLLLYAHDGSDSTSDIIVFQANDGHSFQNILFHVK
NIPKNDRALRLVTNSMVWVPEGGMLKITNRILKAQAPGVRADDIIYKITHSRPQFGEVVL
LMNLPADSPAGPAEEGHHLPDGRMATPISTFTQQDIDDGVVWYRHLGAPTQSDSFRFQVS
SATSAQEHLESHMFNIAILPQAPEAPKLSLGTSLHMTAREDGLSVIQPQSLSFVKAESPS
GKIIYNITVPLHPNQGIIEHRDRPHSPIQYFTQEDINQGQIMYRPPVAPPHLQEIMAFSF
AGLPESVKFYFTVSDGQHTSPEMALTIHLLHSDLQPPAFQVKAPLLEVSPGGRTSLGLQL
LVRDAQVVPEELFFQLQKSPQHGMLVKYTAKSSVTMAAGDTFTYDEVERNVLQYVHDGSS
AWEDSLEISVTDGLTVTTSEVKVEVSPSENRGPRLAPGSSLSMTVASQHTAIITRSHLAY
VDDSSSDPEIWIRLSSLPLYGVLFRSSGPDMDELSGDSNFTMEDINKKNIRYSAVFETDG
HSVTDGFHFSVSDMDGNHVDNQVFTITVTPAENPPHIIAFADLITVDEGGRAPLSLHHFF
ATEDQDNLQDDAVIKLSALPKYGCIENTGTGDRFGPGANSELEASFPIQDVLENYIYYFQ
SVHESIEPTHDVFSFYVSDGSGRSEIHSINITIERKNDEPPRMTLRPLGVRLSSGVAISN
SSLSLQDLDTPDNELIFVLMKKPDHGHLLRRSTASDPLENGTVLDQGSSFTYQDVLAGLV
GYLPGDIYMAVDEFRFSLTDGLHVDTGRMEIYIELPSTNIPHLAINRGLQLSAGSVARIT
EQHLKATDTDSEAGQVVYIMKEDPGAGRLLMAKADNLEQISVRGPIRSFTQADVSQGQIE
YSHGPGEPGGSFAFKFDVVDGEGNKLADQSFSIGVLEDKSPPVVITNRGLVLDENSVEKI
TTAQLSATDQDSKPTELIYRITTQPQLGHLEHVASPGIQISSFTQADLASRNVQYVRSSG
TGKQSDAFSFVLSDGLHEVTQTFPITIHPVDDARPLVQNRGMRVQEGVRKTITEFELKAV
DVDTEAESITFTIVQPPRHGTIERTARGQRFHQTSSFTMEDIYQNRVSYSHDGSNSLKDR
FTFTVSDGTNPFFIIEEGGEEIMTAAPQQFHVDILPVDDGTPRIVTNLGLQWLEYMDGKA
TNLITKKELLTVDPDTEDSQLIYEVTTGPMHGYLENKLQPGRAAATFTQEHVNLGLIRYV
LYEEKIQKVMDSFQFLVKDSKPNVVSDNVFHIQWSLISFKYTSYNVSEKAGSVSVTVQRT
GNLNQYAIVLCRTEQGTASSSSHPGQQDYMEYAGQVQFDEGEGTKSCTVIINDDDVFENI
ESFTVGLSMPAYALLGEFTQAKVVINDTEDEPTLEFDKKTYRVNESAGFLFAPIKRQGDS
SSTVSAVCYTVPKSAMGSSLYALESGSDFKSRGRSAESRVIFGPGVTVSTCDVMVIDDSE
YEEEEEFEIALADASNNARIGRQAVAKVLISGPNDASTVSLGNTAFTISEDAGTVKIPVI
RHGTDLSTFTSVWCATRPSDPASATPGVDYVPSSRKVEFGPGITEQYCTLTILDDTQYPV
IEGLETFVVFLSSAQGAELTKPSQAVIAINDTFQDVPSMQFSKDLLLVKEKEGVLHIPII
RSGDLSYESSVRCYTQGHSAQVMEDFEERRNADSSRITFLKGQKTKNCTVYIHDDSMFEP
EEQFRVYLGHPLGNHWSGARIGKNSVATVTISNDEDAPTIEFEEAAYQVREPAGPEAIAV
LSIKVIRRGDQNRTSKIRCSTRDGSAQSGVDYYPKSRVLKFSPGVDHIFFKVEILSNEDR
EWHESFSLVLGPDDLVEAVLGDVTTATVTILDQEAAGSLILPAPPIVVTLADYDHVEELA
KEGVKKAPSPGYPLVCVTPCDPRYPRYAVMKERCSEAGINQTSVQFSWEVAAPTDGNGAR
SPFETITDNTPFTSVNHKVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNVVTIGTDSA
ICHTPVVAGTARGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPLHN
LHFLLSESIYRHQHVCSNLVTAQDLRGLAEAGFLNDAGFHSTALGPGYDRPFQFDSSVRE
PKTIQLYRHLNLKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYVSY
IYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVIEF
KTHAKFRGQFVIEHHTLPDVKSFILTPDHLGGIQFDLQLLWSAQTFDSPHQLWRATSSYN
RKDYSGEYTIYLIPCTVQPTQPWVDPGEKALACTAHAPERFLIPIAFQQTNRPVPVVYSL
NTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLHSAYKLQLE
KVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRSQPEVTDKYFHDVP
FEAHFASELPDFQVVSSMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDSTSRPRVQR
SLTVSLRRHQRDLVDPSGWLSLDDSLIYDNEGDQVKNGTNMKSLNLEMQEPVIAASLSQT
GASIGSALAAIMLLLLLFLVACFVTRKCQKQKKKQPPEDTLEEYPLNTKVDVAKRNADKV
EKNANRQYCTVRNVNILSDNEGYYTFKGAKVKKLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences Q80T14
10090.ENSMUSP00000043250 ENSMUSP00000043250 ENSMUSP00000043250 NP_780682.3.92730 ENSMUSP00000043250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]