SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043792 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043792
Domain Number 1 Region: 542-622
Classification Level Classification E-value
Superfamily E set domains 7.78e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000041
Further Details:      
 
Domain Number 2 Region: 717-818
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000171
Family Ankyrin repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000043792
Domain Number - Region: 1096-1147
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00106
Family Motor proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043792   Gene: ENSMUSG00000040712   Transcript: ENSMUST00000036299
Sequence length 1208
Comment pep:known chromosome:GRCm38:11:70669463:70687953:-1 gene:ENSMUSG00000040712 transcript:ENSMUST00000036299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEW
LSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCL
YGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLK
WSREELLGQLKPMFHGIKWSCGNGAEEFSVEQLVQQILDTHPTKPAPRTHACLCSGGLGS
GSLTHKCSSTKHRIISPKVEPRALALASISHSKPPEPPPLIAPLPPELPKAHTSPSSSSS
SSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGGLTPTRHLAPQAEPRPPV
SLAVVVGSEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVNPDFPEAEGTHTPCPALE
PAAALEPQAAARGLAPQLGANGRRGNKFFIQDDDSGEELKGPGTVPPVPSSPPSSPSSPT
ALPPSGRATRGEALFGGSAGSSSELEPFSLSSFPDLMGELISDEAPGVPAPAPQLSPALN
AITDFSPEWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVG
LVSLQVAGREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDSQFRMSILERLEQMEKRMA
EIAAAGQAPGQGPEAPPIQDEGQGPGFEARVVVLVESMIPRSTWRGPERLIHGSPFRGMS
LLHLAAAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAV
LLFCWNRQALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQELSVEHPLALSPPSSSPD
TGLSSASSPSELSDGTFSVTSAYSSAPDGSPPPAPPLASDISMEMIPGQLSCGAPETPLL
LMDYEATNSKEPAPSPCGPPLAQDNGAAPEDADSPPAVDVIPVDMISLAKQIIDATPERI
KREDFSEFPDAGASPREHTGTVGLSETMSWLASYLENVDHFPSSAPPSELPFERGRLAIP
PAPSWAEFLSASTSGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVA
AAVIQRCYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQH
YRSYRRRPGPPHRPSGPLPARNKGTFLTKKQDQAARKIMRFLRRCRHRMRELKQNQELEG
LPQPGLAT
Download sequence
Identical sequences Q80Y50
NP_835217.1.92730 ENSMUSP00000043792 ENSMUSP00000043792 10090.ENSMUSP00000043792 ENSMUSP00000098493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]