SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043821 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043821
Domain Number 1 Region: 29-546
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-122
Family ALDH-like 0.000000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043821   Gene: ENSMUSG00000028737   Transcript: ENSMUST00000039818
Sequence length 562
Comment pep:known chromosome:GRCm38:4:139622866:139649690:1 gene:ENSMUSG00000028737 transcript:ENSMUST00000039818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLPSLRRSLLSHAWRGAGLRWKHTSSLKVTNEPILAFSQGSPERDALQKALKDLKGQM
EAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPM
ADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELE
GEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLA
SYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQN
LDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLW
PQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQC
NESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLQLVDSTTSYGLTGA
VFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRW
TSPQVIKETHKPLGDWRYSYMQ
Download sequence
Identical sequences Q8CHT0
ENSMUSP00000043821 ENSMUSP00000043821 NP_780647.3.92730 10090.ENSMUSP00000043821 ENSMUSP00000043821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]