SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045135 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045135
Domain Number 1 Region: 113-232
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000045135
Domain Number - Region: 2-71
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.000186
Family ATP sulfurylase catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045135   Gene: ENSMUSG00000033256   Transcript: ENSMUST00000048635
Sequence length 238
Comment pep:known chromosome:GRCm38:2:122348892:122366828:-1 gene:ENSMUSG00000033256 transcript:ENSMUST00000048635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPYEAQKMMAEIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPRESRLPEDDERP
PEEYDQPWEWKKERISKAFAAQFEGSENCLSPGREEKGRLPPRLSAGNPKSAKPLGMEPS
SPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQ
GFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences Q8CG80
NP_001013851.2.92730 ENSMUSP00000045135 ENSMUSP00000106160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]