SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045430 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045430
Domain Number 1 Region: 350-581
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-31
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045430   Gene: ENSMUSG00000038498   Transcript: ENSMUST00000043380
Sequence length 686
Comment pep:known chromosome:GRCm38:19:5335741:5344153:1 gene:ENSMUSG00000038498 transcript:ENSMUST00000043380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQH
GGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGG
PQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADT
ISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHI
HHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASL
SEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIV
VCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDF
FIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAG
TLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSL
IYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVH
EKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQ
KFRSQAYVIDELVDMAFEAGDDDYGK
Download sequence
Identical sequences Q91ZR5
ENSMUSP00000045430 10090.ENSMUSP00000045430 NP_647462.1.92730 ENSMUSP00000045430 ENSMUSP00000045430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]