SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046103 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046103
Domain Number 1 Region: 14-49,98-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-24
Family Voltage-gated potassium channels 0.0061
Further Details:      
 
Domain Number 2 Region: 162-288
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046103   Gene: ENSMUSG00000033998   Transcript: ENSMUST00000046765
Sequence length 336
Comment pep:known chromosome:GRCm38:8:125995102:126030683:1 gene:ENSMUSG00000033998 transcript:ENSMUST00000046765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHIRWGFSKQVVA
IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDLVHIMEHDQLS
FSSVTEQVAGLKEEQKQSEPFVASQSPPYEDGSADH
Download sequence
Identical sequences O08581
ENSMUSP00000046103 ENSMUSP00000046103 NP_032456.2.92730 10090.ENSMUSP00000046103 ENSMUSP00000046103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]