SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046369 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046369
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-28
Family Kringle modules 0.00089
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046369   Gene: ENSMUSG00000040680   Transcript: ENSMUST00000046525
Sequence length 461
Comment pep:known chromosome:GRCm38:17:23741200:23745829:-1 gene:ENSMUSG00000040680 transcript:ENSMUST00000046525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCL
FWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLA
RGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGP
DRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRT
AALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAA
QASIGARVFSTVTAFSVLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGRSWAVWYR
RPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL
Download sequence
Identical sequences Q8K1S7
ENSMUSP00000046369 NP_082692.1.92730 XP_006525047.1.92730 10090.ENSMUSP00000046369 ENSMUSP00000046369 ENSMUSP00000046369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]