SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046864 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046864
Domain Number 1 Region: 213-374,412-474
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 477-664
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.42e-41
Family cAMP-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 37-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-17
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046864   Gene: ENSMUSG00000034402   Transcript: ENSMUST00000042299
Sequence length 988
Comment pep:known chromosome:GRCm38:12:74897217:75177332:-1 gene:ENSMUSG00000034402 transcript:ENSMUST00000042299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTETVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
EEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
IQGSAQSDPERSQLQVESRPLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRD
AMELKPNGGAEPKCLKVNSPIRMKNGNGKGWLRLKNNMGAQEEKKEDWNNVTKAESMGLL
SEDPKGSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPSQADVKHSFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKLLSEKSVPQTSSPKPQIPLQ
VPPQIPCQDIFSVSRPESPESDKDEINF
Download sequence
Identical sequences Q920E3
ENSMUSP00000046864 NP_766393.2.92730 10090.ENSMUSP00000046864 ENSMUSP00000046864 ENSMUSP00000046864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]