SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049034 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049034
Domain Number 1 Region: 29-219
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000144
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049034   Gene: ENSMUSG00000078517   Transcript: ENSMUST00000042096
Sequence length 994
Comment pep:known chromosome:GRCm38:4:139352587:139378730:1 gene:ENSMUSG00000078517 transcript:ENSMUST00000042096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVASGFWIWAAVLLVPAAAVYEDQVGKFDWRQQYVGKIKFASLEFSPGSKKLVVATE
KNVIAALNSRTGEILWRHVDKGTAEGAVDAMLVHGQDAITVSNGGRLMRSWETNIGGLNW
EITLDTGSFQALGLVGLQESVRYIAVLKKTTLTLHHLSSGHLKWVEHLPESDSILYQMVY
SYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVWTPWLQHLTGACGVVDEAVLVCPD
PSSHSLHTLALETEWELRQIPLQSPDLEFGSGFQPQVLPTQPSPVAPSRAQFFLQLSPSH
YALLHYHHGAVTLLKNFPQATLVSFATTGEKTVAAVMTCRTEVQKPVSAGDGSVASFPET
SGAQDSLACFNQTYTINLYLVETGRRLLDTSISFSLEQKGTRPEQLYIQVFLKKDDSVGY
RALVQTQDHLQLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADG
LLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVTV
TASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETGMS
SLFVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLVDDEYKVTAFPATRNVL
RQLHELAPSIFFYLVDAEQGRLSGYQLRKDLTTELSWELTIPPEVQRVVKVKGKRSSEHV
HSQGRVMGDRSVLYKSLNPNLLAVVTESTDVHHERTFIGIFLIDGVTGRIIHSSVQKKAR
GPVHLVHSENWVVYQYWNSKARRNELTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYI
FPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYS
PDVQVHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDD
YDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences ENSMUSP00000049034 NP_001034289.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]