SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051512 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051512
Domain Number 1 Region: 1120-1225
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.06e-26
Family Lipoxigenase N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 34-147
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000388
Family C-type lectin domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000051512
Domain Number - Region: 1898-1948,1986-2111
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000698
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051512   Gene: ENSMUSG00000048827   Transcript: ENSMUST00000057344
Sequence length 2151
Comment pep:known chromosome:GRCm38:8:109614517:109670721:1 gene:ENSMUSG00000048827 transcript:ENSMUST00000057344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQRRSWLWLYIRIGVILGDILGRKPSIREQHGGNSCYQLNRLFCDFQEADNYCHAQRG
RLAHTWNPKLRGFLKSFLNEETVWWVRGNLTLPGSHPGINQTGGDDVLRNQKPGECPSVV
THSNAVFSRWNLCIEKHHFICQAAAFPPQGASIWRNEFGPGPLLPMKRRGAETERHMIPG
NGPPLAMCHQPAPPELFETLCFPIDPASSAPPKATHRMTITSLTGRPQVTSDTLASSSPP
QGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPA
SSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQGT
LDTPSSSSPPQGTSDTPASSSPPQGTSETPASNSPPQGTSETPGFSSPPQVTTATLVSSS
PPQVTSETPASSSPTQVTSETPASSSPTQVTSDTPASNSPPQGTSDTPGFSSPTQVTTAT
LVSSSPPQVTSDTPASSSPPQVTSDTPASSSPPQVTSETPASSSPPQVTSDTSASISPPQ
VISDTPASSSPPQVTSETPASSSPTNMTSDTPASSSPTNMTSDTPASSSPTNMTSDTPAS
SSPPWPVITEVTRPESTIPAGRSLANITSKAQEDSPLGVISTHPQMSFQSSTSQALDETA
GERVPTIPDFQAHSEFQKACAILQRLRDFLPTSPTSAQVSVANLLIDLSEQLLVLPFQKN
NSWSSQTPAVSCPFQPLGRLTTTEKSSHQMAQQDMEQVEDMLETSLMALGEIHRAFCQQS
LCPQSAVTLASPSATLMLSSQNVSTLPLSTYTLGEPAPLTLGFPSAEALKELLNKHPGVN
LQVTGLAFNPFKTLDDKNIVGSIGNVQLSSAYQSIRVHDLIEDIEIMLWRNASMETQPTS
LNTSTDHFTISVNITSLEKTLIVTIEPESPLLMTLHLGFQDQLAHTHFYLNISLPRDQVW
QKDEEYTWVLTPENLWYGTGTYYIMAVENKSTEAAQHTPVLVSVVTAVTQCYFWDRYNRT
WKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIKLLLHVTNNPVGVSLL
SSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVV
ITLYGSEGHSEPHHLCDPEKTVFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYV
SQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQ
DYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQLGPLAVT
LSELLVSIQTSIILFPIHLIFGRLFQLIHPPEALPQLPFIQAAWPPALVCESPSLTQVVK
ELKETVGFLLRRNTQLLSECEPSSCSSCDINKLAKLLSGLIYCHLEDEGCHQQTESHWED
AVSENHYHFCRYLLQLLRRLKAHLEALGATQDHQSCDFSEAVSQLQNLQELLETQTLRRG
PGPCRHSTSFPILSPGEGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQ
ATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCP
WSAPGLRDKNNPIYTAPAMNNLAKPTRKAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKD
SSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTLLPNLYGDYRGFITDGNSFLLGNVLI
RQTRIPNDIFFPGSLHKQMKSPPQHQEDRENYGAGWVPPDTNITKVDSIWHYQNQESLGG
YPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLL
CAVTLILESSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKR
QRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNS
AVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEVLGFILIIVVLLSSYAMTFN
LLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLLVLSSIILMGLVIINLF
VSAILIAFGKERKACEKEATLTDMLLQKLSSLLGIRLHQNPSEEHADNTGY
Download sequence
Identical sequences A2A258
ENSMUSP00000051512 NP_853522.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]