SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052872 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052872
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 7.79e-73
Family Thiolase-related 0.0023
Further Details:      
 
Domain Number 2 Region: 2218-2494
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.8e-62
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000503
Further Details:      
 
Domain Number 3 Region: 492-617,680-777
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.91e-40
Family FabD-like 0.0055
Further Details:      
 
Domain Number 4 Region: 1633-1794
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.19e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1876-2065
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.71e-35
Family Tyrosine-dependent oxidoreductases 0.00017
Further Details:      
 
Domain Number 6 Region: 1551-1667
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000128
Family Alcohol dehydrogenase-like, N-terminal domain 0.0055
Further Details:      
 
Domain Number 7 Region: 1217-1396
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000000474
Family UbiE/COQ5-like 0.09
Further Details:      
 
Domain Number 8 Region: 2117-2183
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000497
Family Acyl-carrier protein (ACP) 0.0000835
Further Details:      
 
Domain Number 9 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000183
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052872   Gene: ENSMUSG00000025153   Transcript: ENSMUST00000055655
Sequence length 2504
Comment pep:known chromosome:GRCm38:11:120805940:120824178:-1 gene:ENSMUSG00000025153 transcript:ENSMUST00000055655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVSYEAIVDGGINPASLRGTNTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGEC
PAALVGGINLLLKPNTSVQFMKLGMLSPDGTCRSFDDSGSGYCRSEAVVAVLLTKKSLAR
RVYATILNAGTNTDGSKEQGVTFPSGEVQEQLICSLYQPAGLAPESLEYIEAHGTGTKVG
DPQELNGITRSLCAFRQAPLLIGSTKSNMGHPEPASGLAALTKVLLSLEHGVWAPNLHFH
NPNPEIPALLDGRLQVVDRPLPVRGGNVGINSFGFGGSNVHVILQPNTRQAPAPTAHAAL
PHLLHASGRTLEAVQDLLEQGRQHSQDLAFVSMLNDIAATPTAAMPFRGYTVLGVEGRVQ
EVQQVSTNKRPLWFICSGMGTQWRGMGLSLMRLDSFRESILRSDEAVKPLGVKVSDLLLS
TDERTFDDIVHAFVSLTAIQIALIDLLTSVGLKPDGIIGHSLGEVACGYADGCLSQREAV
LAAYWRGQCIKDAHLPPGSMAAVGLSWEECKQRCPAGVVPACHNSEDTVTISGPQAAVNE
FVEQLKQEGVFAKEVRTGGLAFHSYFMEGIAPTLLQALKKVIREPRPRSARWLSTSIPEA
QWQSSLARTSSAEYNVNNLVSPVLFQEALWHIPEHAVVLEIAPHALLQAVLKRGVKSSCT
IIPLMKRDHKDNLEFFLTNLGKVHLTGINVNPNALFPPVEFPAPRGTPLISPHIKWDHSQ
TWDVPVAEDFPNGSSSSSATVYSIDASPESPDHYLVDHCIDGRVIFPGTGYLCLVWKTLA
RSLGLSLEETPVVFENVSFHQATILPKTGTVALEVRLLEASHAFEVSDTGNLIVSGKVYL
WEDPNSKLFDHPEVPTPPESASVSRLTQGEVYKELRLRGYDYGPQFQGICEATLEGEQGK
LLWKDNWVTFMDTMLQVSILGSSQQSLQLPTRVTAIYIDPATHRQKVYRLKEDTQVADVT
TSRCLGITVSGGIHISRLQTTATSRRQQEQLVPTLEKFVFTPHMEAECLSESTALQKELQ
LCKGLARALQTKATQQGLKAAMLGQEDPPQHGLPRLLAAACQLQLNGNLQLELGEALAQE
RLLLPEDPLISGLLNSQALKACVDTALENLSTLKMKVAEVLAGEGHLYSRIPALLNTQPM
LQLEYTATDRHPQALKDVQTKLQQHDVAQGQWNPSDPAPSSLGALDLLVCNCALATLGDP
ALALDNMVAALKEGGFLLVHTVLKGHALGETLACLPSEVQPAPSLLSQEEWESLFSRKAL
HLVGLKRSFYGTALFLCRRAIPQEKPIFLSVEDTSFQWVDSLKSTLATSSSQPVWLTAMD
CPTSGVVGLVNCLRKEPGGHRIRCILLSNLSNTSHAPKLDPGSPELQQVLKHDLVMNVYR
DGAWGAFRHFQLEQDKPKEQTAHAFVNVLTRGDLASIRWVSSPLKHTQPSSSGAQLCTVY
YASLNFRDIMLATGKLSPDAIPGKWASRDCMLGMEFSGRDRCGRRVMGLVPAEGLATSVL
LSSDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGRIQRGETVLIHSGSGGVGQAAISI
ALSLGCRVFTTVGSAEKRAYLQARFPQLDDTSFANSRDTSFEQHVLLHTGGKGVDLVLNS
LAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEEANDSW
REVAALLKAGIRDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLVQVREEEPEAVLPG
AQPTLISAISKTFCPAHKSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQAK
HIREWRRQGIQVLVSTSNVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPEL
FQDVNKPKYNGTLNLDRATREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQ
RRHDGLPGLAVQWGAIGDVGIVLEAMGTNDTVIGGTLPQRISSCMEVLDLFLNQPHAVLS
SFVLAEKKAVAHGDGDTQRDLVKAVAHILGIRDLAGINLDSTLADLGLDSLMGVEVRQIL
EREHDLVLPMREVRQLTLRKLQEMSSKTDSATDTTAPKSRSDTSLKQNQLNLSTLLVNPE
GPTLTQLNSVQSSERPLFLVHPIEGSTTVFHSLAAKLSVPTYGLQCTQAAPLDSIPNLAA
YYIDCIKQVQPEGPYRIAGYSFGACVAFEMCSQLQAQQGPAPTHNNLFLFDGSHTYVLAY
TQSYRAKMTPGCEAEAEAEALCFFIKQFLDVEHSKVLEALLPLKSLEDRVAASVDLITKS
HHSLDRRELSFAAVSFYHKLRAADQYKPKAKYHGNVTLLRAKTGGTYGEDLGADYNLSQV
CDGKVSVHIIEGDHRTLLEGSGLESIINIIHSSLAEPRVSVREG
Download sequence
Identical sequences P19096
ENSMUSP00000052872 ENSMUSP00000052872 NP_032014.3.92730 10090.ENSMUSP00000052872 ENSMUSP00000052872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]