SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053033 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053033
Domain Number 1 Region: 56-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 9.94e-48
Family Ribosomal protein S7 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053033   Gene: ENSMUSG00000046756   Transcript: ENSMUST00000058109
Sequence length 242
Comment pep:known chromosome:GRCm38:11:115603925:115608036:1 gene:ENSMUSG00000046756 transcript:ENSMUST00000058109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALRAPLRWSGLALGVRCAVWNLPGLTQVRGSRYAPEFREPLIDKEYYRKPVAELTE
EEKYDQELKKTQFIKAAAATETSSVFADPVISKFTNMMMKGGNKVLARSLMAQTLEAVKR
KQFEKYRAASAEEQATIERNPYRIFHEALKNCEPVIGLVPILKGGHFYQVPVPLADRRRR
FLAMKWMITECRENKPRRTLMPEKLSHELLEAFHNRGPVIKRKHNMHKMAEANRALAHYR
WW
Download sequence
Identical sequences Q80X85
ENSMUSP00000053033 10090.ENSMUSP00000112023 NP_079581.1.92730 ENSMUSP00000053033 ENSMUSP00000053033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]