SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053223 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053223
Domain Number 1 Region: 236-350
Classification Level Classification E-value
Superfamily Acid proteases 2.21e-26
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.59e-19
Family Ubiquitin-related 0.00000546
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000053223
Domain Number - Region: 149-191
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0693
Family XPC-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053223   Gene: ENSMUSG00000047619   Transcript: ENSMUST00000051706
Sequence length 408
Comment pep:known chromosome:GRCm38:9:6265028:6266547:-1 gene:ENSMUSG00000047619 transcript:ENSMUST00000051706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCS
LGSYGLKDGDMVVLLQKDNVGLRTPGRTPNHPRADFTGSGSAVPGTSSSRHPHQHQHHYH
HHQRIPSTQQAHGLASGENMTFAQELDSPALIRSMLLSNPHDLSLLKERNPALAEALLSG
NLETFSQVLMEQQRERTLREQEMFRLYSTNPFDQETQARIEEEIRQQNIEENMNIAMEEA
PESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWGGVAKGVG
TQRIMGRVHLAQIQIEGDFLQCSFSILEEQPMDILLGLDMLRRHQCSIDLKKNVLVIGTT
GSQTHFLPEGELPLCAKLLSGTVQEESSDREVGGTIKHPVKGPGRKKH
Download sequence
Identical sequences Q9DAF3
10090.ENSMUSP00000053223 ENSMUSP00000053223 NP_082218.1.92730 ENSMUSP00000053223 ENSMUSP00000053223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]