SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053341 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000053341
Domain Number - Region: 77-116
Classification Level Classification E-value
Superfamily LysM domain 0.00379
Family LysM domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053341   Gene: ENSMUSG00000043831   Transcript: ENSMUST00000058771
Sequence length 293
Comment pep:known chromosome:GRCm38:7:67222544:67228468:1 gene:ENSMUSG00000043831 transcript:ENSMUST00000058771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKEVLAKSFQGPAAVCRTPNSHVYMFNNGSGDSGDSSEEESHQVVLRPRGKEHQKNSS
QRPGAGTMVLLQRELAQEDSLNKLALQYGCKVADIKKANNFIREQDLYALKSIKIPVRNH
GILTETHQELMPLGASSSETRVTLVDLPEDEDAGGATTQGNQLTDFFKGIDENIERAVHS
DVFHGDSCCVEAPDQLLLPITQKPVADGADCGIQWWNAVFLMLLIGIVLPVFYLVYFKIQ
ATGEPSNGLNATVVPNGSMTLSPVPGQAPRLAIPVPTLPASDSQVSPTTQAGA
Download sequence
Identical sequences Q8CC84
10090.ENSMUSP00000053341 NP_001177980.1.92730 NP_780424.1.92730 ENSMUSP00000053341 ENSMUSP00000053341 ENSMUSP00000053341 ENSMUSP00000136151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]