SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054963 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054963
Domain Number 1 Region: 360-562
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-29
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 73-199
Classification Level Classification E-value
Superfamily POZ domain 5.76e-27
Family BTB/POZ domain 0.0029
Further Details:      
 
Domain Number 3 Region: 594-660
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000124
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054963   Gene: ENSMUSG00000048732   Transcript: ENSMUST00000056665
Sequence length 709
Comment pep:known chromosome:GRCm38:11:100462614:100472741:-1 gene:ENSMUSG00000048732 transcript:ENSMUST00000056665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAAAAAAAAAASFQVLEMESMETAVAGSASLAAEVRGSGTVDFVTGAGISTLVDT
GGSDPGPEAEDFECSTHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAAT
EYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLEL
ADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFYKVIQDE
EFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKP
TYLTRHVKPERLVANNEVCVKLVAEAVERHALRAENIQSGTLQQPTSQVSLLPRYGQNMD
VIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAITESYVYVAGSMEPGF
AKTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELD
KWHNLESAPKILRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVES
LPLIDNYCFFQMSVVNSNFYQTASCCPKSYSLENEEAVRKIAGQVSDEILESLPPEVLSI
EGAAICYYRDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHV
RIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Download sequence
Identical sequences Q14DU1 Q8CE33
ENSMUSP00000054963 NP_766153.1.92730 ENSMUSP00000054963 10090.ENSMUSP00000054963 ENSMUSP00000054963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]