SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057854 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057854
Domain Number 1 Region: 23-157
Classification Level Classification E-value
Superfamily dUTPase-like 8.11e-49
Family dUTPase-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057854   Gene: ENSMUSG00000027203   Transcript: ENSMUST00000051605
Sequence length 162
Comment pep:known chromosome:GRCm38:2:125247482:125258608:1 gene:ENSMUSG00000027203 transcript:ENSMUST00000051605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSEDAAAVSASKRARAEDGASLRFVRLSEHATAPTRGSARAAGYDLFSAYDYTISPME
KAIVKTDIQIAVPSGCYGRVAPRSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
VKKGDRIAQLICERISYPDLEEVQTLDDTERGSGGFGSTGKN
Download sequence
Identical sequences Q9CQ43
ENSMUSP00000057854 NP_076084.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]