SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058142 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058142
Domain Number 1 Region: 104-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000492
Family VWC domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000058142
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily FnI-like domain 0.00241
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number - Region: 176-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.00607
Family VWC domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058142   Gene: ENSMUSG00000045648   Transcript: ENSMUST00000053922
Sequence length 222
Comment pep:known chromosome:GRCm38:1:70725715:70885397:1 gene:ENSMUSG00000045648 transcript:ENSMUST00000053922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPIYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDDCNICHCHNGDWWKPAQCSKRECQGKQTV
Download sequence
Identical sequences Q505H4
10090.ENSMUSP00000058142 NP_796138.2.92730 XP_006496126.1.92730 ENSMUSP00000058142 ENSMUSP00000058142 ENSMUSP00000058142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]