SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058958 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058958
Domain Number 1 Region: 1107-1246
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.88e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 
Domain Number 2 Region: 229-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000871
Family Calponin-homology domain, CH-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058958   Gene: ENSMUSG00000044433   Transcript: ENSMUST00000057028
Sequence length 1252
Comment pep:known chromosome:GRCm38:8:3587450:3609074:1 gene:ENSMUSG00000044433 transcript:ENSMUST00000057028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEAAPAGSGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPPELWEPF
YTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEPSPSPSALLALLARRGTVPSLPEH
PVREADLKHQPILMGAHLAVIDALMVAFSFEWTKTLPGPLALSSLEHKLLFWVDTTVRRL
QEKTEQEAAQRASPAAPLDGASPAQPSIRYRKDRAIARRAPCFPNVTTLQDLASGAALAA
TIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASHLPRGCPLSLEDLLYVPPPLK
VNLVVLLAEMYMCFEVLKPDFVQAKDLPDGHAVSPRNTETVPSQNNSGSSSPVFNFRHPL
LSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVV
MGDPVLLRSVSSDSLGPPRPVSTSSRNSAQPAPESGDLPTIEEALQIIHSAEPRLLPDGA
ADGSFYLHSPEGLSKPPLSPYPPEGASKPLSDRLNKAPIYISHPENPSKSSPCSTGEILK
PPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESGLGSPTSTPVAPEALSSE
MSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREAAGEAEEEAELGSVP
GGERPAGEGQGEPSLRHKSVTFSPDLGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLTD
QQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPAARRSPGPGPSPTPRSPK
HARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLSEGTPPEEPTTKPA
LIEIPLASLGEPAADEEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYKDEDKPEDEMAQK
RASLLERQQRRVEEARRRKQWQEAEKEQKREEAARLAQEAPGLAFTTPVVASAAPVATLA
PTTRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRASGTGGPGRGGRRATR
PRSGCCDDSALARSPARGLLGSRLSKVYSQSTLSLSTVANEAPNNLGVKRPTSRAPSPSG
LMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGK
VNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAM
VEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK
Download sequence
Identical sequences Q80VC9
10090.ENSMUSP00000058958 ENSMUSP00000058958 NP_081447.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]