SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060793 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060793
Domain Number 1 Region: 633-781
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-45
Family Toll/Interleukin receptor TIR domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 35-165,351-569
Classification Level Classification E-value
Superfamily L domain-like 3.4e-41
Family Ngr ectodomain-like 0.056
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000060793
Domain Number - Region: 239-395
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0523
Family Pectate lyase-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060793   Gene: ENSMUSG00000044827   Transcript: ENSMUST00000059349
Sequence length 795
Comment pep:known chromosome:GRCm38:5:64924811:64932761:-1 gene:ENSMUSG00000044827 transcript:ENSMUST00000059349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKPNSLIFYCIIVLGLTLMKIQLSEECELIIKRPNANLTRVPKDLPLQTTTLDLSQNNI
SELQTSDILSLSKLRVLIMSYNRLQYLNISVFKFNTELEYLDLSHNELKVILCHPTVSLK
HLDLSFNAFDALPICKEFGNMSQLQFLGLSGSRVQSSSVQLIAHLNISKVLLVLGDAYGE
KEDPESLRHVSTETLHIVFPSKREFRFLLDVSVSTTIGLELSNIKCVLEDQGCSYFLRAL
SKLGKNLKLSNLTLNNVETTWNSFINILQIVWHTPVKYFSISNVKLQGQLAFRMFNYSDT
SLKALSIHQVVTDVFSFPQSYIYSIFANMNIQNFTMSGTHMVHMLCPSQVSPFLHVDFTD
NLLTDMVFKDCRNLVRLKTLSLQKNQLKNLENIILTSAKMTSLQKLDISQNSLRYSDGGI
PCAWTQSLLVLNLSSNMLTGSVFRCLPPKVKVLDLHNNRIMSIPKDVTHLQALQELNVAS
NSLTDLPGCGAFSSLSVLVIDHNSVSHPSEDFFQSCQNIRSLTAGNNPFQCTCELRDFVK
NIGWVAREVVEGWPDSYRCDYPESSRGTALRDFHMSPLSCDTVLLTVTIGATMLVLAVTG
AFLCLYFDLPWYVRMLCQWTQTRHRARHIPLEELQRNLQFHAFVSYSGHDSAWVKNELLP
NLEKDDIQICLHERNFVPGKSIVENIINFIEKSYKSIFVLSPHFIQSEWCHYELYFAHHN
LFHEGSDNLILILLAPIPQYSIPTNYHKLKTLMSRRTYLEWPTEKNKHGLFWANLRASIN
VKLVNQAEGTCYTQQ
Download sequence
Identical sequences B9EJ46 Q9EPQ1
NP_001263374.1.92730 NP_109607.1.92730 XP_006503914.1.92730 XP_006503915.1.92730 XP_006503916.1.92730 XP_006503917.1.92730 XP_006503919.1.92730 XP_011239022.1.92730 ENSMUSP00000060793 ENSMUSP00000060793 ENSMUSP00000060793 10090.ENSMUSP00000060793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]