SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062327 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062327
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 8.4e-52
Family Extradiol dioxygenases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062327   Gene: ENSMUSG00000043155   Transcript: ENSMUST00000055436
Sequence length 371
Comment pep:known chromosome:GRCm38:4:116819904:116821707:-1 gene:ENSMUSG00000043155 transcript:ENSMUST00000055436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPARRLCHIAFHVPAGQPLARDLHRVFGFQPLAVREAGGWRQLALRSGDAVFLVNEGT
GPQEPLYSLDPHHSVPSATNLCFDVEDVDGAARALAARGCIMPVPPTRVRDAQGTATYTV
LSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPGPGWVSHVDHLTLACTSGSSPMLMRWF
HDCLGFHHLPLSPGEDPEMGLKVAAGSGRGGLRLTALQTPPNNTVPTLVLAESLPGLNSK
QDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGCRLLTPPEAYYQQPGKEEQILAA
GHKPGLLERQGILLDGDKDEFLLQVFTKSLFAEDTFFLELIQRQGATGFGQNNIRALWQS
VQEEAARAQGA
Download sequence
Identical sequences Q8K248
ENSMUSP00000062327 ENSMUSP00000062327 10090.ENSMUSP00000062327 NP_666368.1.92730 ENSMUSP00000062327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]