SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062992 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062992
Domain Number 1 Region: 220-301
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000288
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000113
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000062992
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 443-554
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.017
Family Apolipoprotein A-I 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062992   Gene: ENSMUSG00000045903   Transcript: ENSMUST00000056129
Sequence length 802
Comment pep:known chromosome:GRCm38:19:4984355:4989971:-1 gene:ENSMUSG00000045903 transcript:ENSMUST00000056129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSSGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDVSESVLIYL
GFERSELLCKSWYGLLHPEDLAQASSQHYRLLAESGDIQAEMVVRLQAKHGGWTWIYCML
YSEGPEGPFTANNYPISDTEAWSLRQQLNSEDTQAAYVLGTPAVLPSFSENVFSQEQCSN
PLFTPSLGTPRSASFPRAPELGVISTPEELPQPSKELDFSYLPFPARPEPSLQADLSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDP
LTSSLQGQLTESSARSFEDQLTPCTSSFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQA
HLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGVDRPFSAEAGTGGLE
PLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTP
DPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences Q8BGD7
NP_705781.1.92730 XP_006531783.1.92730 XP_006531784.1.92730 XP_011246921.1.92730 ENSMUSP00000062992 10090.ENSMUSP00000062992 ENSMUSP00000062992 ENSMUSP00000062992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]