SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063258 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063258
Domain Number 1 Region: 397-529
Classification Level Classification E-value
Superfamily CalX-like 1.96e-33
Family CalX-beta domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 529-681
Classification Level Classification E-value
Superfamily CalX-like 8.76e-31
Family CalX-beta domain 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063258   Gene: ENSMUSG00000079055   Transcript: ENSMUST00000064594
Sequence length 927
Comment pep:novel chromosome:GRCm38:12:81198276:81332959:-1 gene:ENSMUSG00000079055 transcript:ENSMUST00000064594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLRLQPLTSAFLHFGLVTFVLFLNCLRAEAGDSGDVPSAGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
FTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVR
KGGDISKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRVEEEQLAEGMLPAILNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISALLLSPEVTDRKLTVEEEEAKRIAEMGKPVL
GEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAGGDEDEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFG
CTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW
SVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLA
TTWLFVSLWLLYILFATLEAYCYIKGF
Download sequence
Identical sequences E9PX50
XP_006515474.1.92730 XP_006515475.1.92730 ENSMUSP00000063258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]