SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063511 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063511
Domain Number 1 Region: 29-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-80
Family Carbonic anhydrase 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063511   Gene: ENSMUSG00000041261   Transcript: ENSMUST00000066674
Sequence length 291
Comment pep:known chromosome:GRCm38:4:8143362:8239041:-1 gene:ENSMUSG00000041261 transcript:ENSMUST00000066674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREA
RYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHW
GRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGL
KAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP
LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences P28651
ENSMUSP00000063511 NP_031618.2.92730 10090.ENSMUSP00000095891 ENSMUSP00000063511 ENSMUSP00000063511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]