SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063762 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000063762
Domain Number - Region: 109-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0036
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063762   Gene: ENSMUSG00000043614   Transcript: ENSMUST00000067935
Sequence length 261
Comment pep:novel chromosome:GRCm38:5:135072900:135078266:-1 gene:ENSMUSG00000043614 transcript:ENSMUST00000067935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLAS
NYALAKENLALRPRLEMGRTALAIKYQELREVAENCADKLQRLEKSMHRWSPQCALGWLQ
AELEEAEQEAEVQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQEVLRRRERSAQ
PAPTTAAAAAAAATAMDPPKPFPAAAVLPTGAARGPPPAVPRSLPPLDSRPVPPVKGSPG
CPFGPAPLLSPRPSQPEPPHR
Download sequence
Identical sequences B2GV76 Q810I0
10090.ENSMUSP00000063762 ENSRNOP00000067165 ENSMUSP00000063762 NP_001121665.1.100692 NP_001121665.1.4139 NP_001186606.1.92730 ENSMUSP00000063762 ENSMUSP00000063762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]