SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065089 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065089
Domain Number 1 Region: 52-527
Classification Level Classification E-value
Superfamily ALDH-like 6.81e-134
Family ALDH-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065089   Gene: ENSMUSG00000053644   Transcript: ENSMUST00000066208
Sequence length 539
Comment pep:known chromosome:GRCm38:18:56526744:56562309:-1 gene:ENSMUSG00000053644 transcript:ENSMUST00000066208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
FREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIE
MWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLED
NLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVG
NPWDPNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHD
APIVHQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ
Download sequence
Identical sequences Q9DBF1
10090.ENSMUSP00000112334 NP_613066.2.92730 ENSMUSP00000065089 ENSMUSP00000065089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]