SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066701 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066701
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-24
Family V set domains (antibody variable domain-like) 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066701   Gene: ENSMUSG00000056569   Transcript: ENSMUST00000070758
Sequence length 248
Comment pep:known chromosome:GRCm38:1:171150711:171161130:1 gene:ENSMUSG00000056569 transcript:ENSMUST00000070758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIR
YCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGL
GESRKDKK
Download sequence
Identical sequences E9QK82
ENSMUSP00000066701 ENSMUSP00000066701 10090.ENSMUSP00000106966 ENSMUSP00000066701 ENSMUSP00000106966 NP_001302428.1.92730 NP_032649.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]