SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066741 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066741
Domain Number 1 Region: 117-161
Classification Level Classification E-value
Superfamily LysM domain 0.0000000536
Family LysM domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066741   Gene: ENSMUSG00000039697   Transcript: ENSMUST00000068567
Sequence length 943
Comment pep:known chromosome:GRCm38:10:30645584:30803107:-1 gene:ENSMUSG00000039697 transcript:ENSMUST00000068567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKEQKERKQSYFARLKKKKQAKQNAEIVSAASSKSRSGKDDANSDILEQDKFNV
TAEGDHSTDDKKKRKSNQLKEIRRTELKRYYSVDDNQNKTHDKKEKKMMVQKPQGTMEYT
AGSQDTLNSVALKFNVTPNKLVELNKLFTHTIVPGQVLFVPDANISSSTIQLSSSTPGAT
VSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVG
GVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYSDISHMKIKDALPSDL
PRDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGERTLALDAKSVRSPEESTER
TCTRIEPPDNSELWKLKNLQSSRGTTSESPSVTQLSMRAALEPTAKENCLLKGDEDFVDL
EELSSQPESGINKGDATKECLSYDQKKDGPHTVMSAKKGHVQSAQEVMGPESDTELKGAL
DLETAEKQDEAPEVDKHSGSPENLGESTLNIHEDLDKIKLIEFYLNKNKEGSQLLENVQK
SELSDRKSIEPGGIDITLSSSLPQAGDSPPEDNKEPGTLWVKGGETLPLKLDPSAEETVI
NNKEVLDSLGSSLDKMCHSAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCI
KVGKPMRKSFASHTATMVQQYSKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKE
QGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEEEEEEEEGLPILQPH
SALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMD
NQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGG
RFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences Q6DFV7
NP_766083.3.92730 10090.ENSMUSP00000066741 ENSMUSP00000066741 ENSMUSP00000066741 ENSMUSP00000066741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]