SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066859 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066859
Domain Number 1 Region: 10-190
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.07e-46
Family Isochorismatase-like hydrolases 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066859   Gene: ENSMUSG00000052605   Transcript: ENSMUST00000064547
Sequence length 210
Comment pep:known chromosome:GRCm38:7:4844959:4866193:-1 gene:ENSMUSG00000052605 transcript:ENSMUST00000064547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAKASLGRIFPESSILFLCDMQEKLRDRILYFPQIVSKAARMLKVAQMLEIPVLLTEH
YPQGLGPTVPELGAQGLRTMSKTSFSMVPPLQQELDKLPQLQSVLLCGIETQGCILHTAL
DLLDRGLQVHVAVDACSSQSEMNRLVALARMQQSGVFLSTSEVLILQLVKDAAHPQFKEI
QKILKEPVTDIGLLGFFQGKKNSLLPNSRT
Download sequence
Identical sequences Q9DCC7
10090.ENSMUSP00000066859 ENSMUSP00000066859 NP_080434.1.92730 ENSMUSP00000066859 ENSMUSP00000066859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]