SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067767 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067767
Domain Number 1 Region: 2-428
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-129
Family ALDH-like 0.000000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067767   Gene: ENSMUSG00000010025   Transcript: ENSMUST00000066277
Sequence length 532
Comment pep:known chromosome:GRCm38:11:61223417:61267185:-1 gene:ENSMUSG00000010025 transcript:ENSMUST00000066277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQVLRLRQAFRSGRSRPLRFRLQQLEALRRMVQEREKEILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTMQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYAIVNGGIPETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRIAWGKYMNCGQT
CIAPDYILCEASLQNQIVQKIKETVKDFYGENIKASPDYERIINLRHFKRLQSLLKGQKI
AFGGEMDEATRYLAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVDEAINFINDREKPLA
LYVFSRNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWAKFFLLKQFNKGRLGMLLFVCLVAVAAVIV
KHPVRSRNPDSVQSSLRDADLVDFPVSSSPCLGDTGVSCQLNRQHLEVNFLW
Download sequence
Identical sequences B1ATI0
ENSMUSP00000067767 10090.ENSMUSP00000067767 ENSMUSP00000067767 ENSMUSP00000067767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]