SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067811 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067811
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000405
Family LysM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067811   Gene: ENSMUSG00000053769   Transcript: ENSMUST00000066386
Sequence length 226
Comment pep:known chromosome:GRCm38:3:95134088:95139518:1 gene:ENSMUSG00000053769 transcript:ENSMUST00000066386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPLGGSGLLHGSRARSYGSLVQSSCSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRTNRLYTNDSIFLKKTLYIPILSEPRDLFNGLDSEEENDGEEEVRPSKDEIGSSS
GRRKNRGSGSGRPNGTGLPPHQETSTPSHDLSASDFLKKLDSQISLSKKAAAQKLRKGES
GVPEEDTGLYPSSPRMQQRAVLGPVPLTRTSRTQTLRDQEDEIFKL
Download sequence
Identical sequences A6H624 Q9D0E3
10090.ENSMUSP00000067811 NP_694761.1.92730 ENSMUSP00000067811 ENSMUSP00000136020 ENSMUSP00000067811 ENSMUSP00000132549 ENSMUSP00000067811 ENSMUSP00000136020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]