SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000068562 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000068562
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.18e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000068562
Domain Number - Region: 242-288
Classification Level Classification E-value
Superfamily ARM repeat 0.0038
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000068562   Gene: ENSMUSG00000020962   Transcript: ENSMUST00000063314
Sequence length 339
Comment pep:putative chromosome:GRCm38:12:91558688:91590487:-1 gene:ENSMUSG00000020962 transcript:ENSMUST00000063314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQ
QAQTQQVLIPASQQATAPQVIVPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLT
NSGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQT
GVIIQPQQILFTGNKTQVIPTTVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTG
DTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVC
QYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences Q149E9
NP_780544.1.92730 ENSMUSP00000068562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]