SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000068850 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000068850
Domain Number 1 Region: 20-194
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 3.01e-45
Family Peptidyl-tRNA hydrolase-like 0.0000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000068850   Gene: ENSMUSG00000053746   Transcript: ENSMUST00000066352
Sequence length 204
Comment pep:known chromosome:GRCm38:2:32775786:32777597:1 gene:ENSMUSG00000053746 transcript:ENSMUST00000066352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSWALSRQVSEARFPGKRWLVAGLGNHGMPGTRHSVGMAVLGQIARRLGVAENWTRDS
RCAADLALAPLGDAQLVLLRPRRLMNVNGRSVARAAELFGLTAEEIYLVHDELDKPLGKL
ALKLGGSARGHNGVRSCISCLNSNAMPRLLVGIGRPTHPNMVENHVLGCFSPEEQELLSP
LMDQATDLLLDHIRARSQGPLSGL
Download sequence
Identical sequences Q8BW00
ENSMUSP00000068850 ENSMUSP00000068850 NP_848710.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]