SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069416 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069416
Domain Number 1 Region: 133-379
Classification Level Classification E-value
Superfamily vWA-like 5e-81
Family Integrin A (or I) domain 0.0000000261
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 633-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.18e-18
Family Integrin beta tail domain 0.00038
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000513
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000069416
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069416   Gene: ENSMUSG00000022817   Transcript: ENSMUST00000069345
Sequence length 816
Comment pep:known chromosome:GRCm38:16:33829677:33949153:1 gene:ENSMUSG00000022817 transcript:ENSMUST00000069345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVPATLYACLLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGNPRSI
TSRCDLKANLIRNGCEGEIESPASSTHVLRNLPLSSKGSSATGSDVIQMTPQEIAVSLRP
GEQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLENIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGISYPGQRKCEGLKIGD
TASFEVSVEARSCPGRQAAQSFTLRPVGFRDSLQVEVAYNCTCGCSTGLEPNSARCSGNG
TYTCGLCECDPGYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GRIYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDVSTCRAKDGQ
ICSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSSKRDCVECLLLHQGKPDNQTCHHQ
CKDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFSYTELPNGRSNLTVLREPECGSAPNA
MTILLAVVGSILLIGMALLAIWKLLVTIHDRREFAKFQSLKPPVQKAHLHTHCRFRLQQV
QQILQWLSGLRLLDGWRGTKDEDSGVPWTSWTICSR
Download sequence
Identical sequences G5E8F8
ENSMUSP00000110680 NP_034710.2.92730 10090.ENSMUSP00000069416 ENSMUSP00000069416 ENSMUSP00000069416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]